Lineage for d7dkzc_ (7dkz C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2556026Protein automated matches [236563] (6 species)
    not a true protein
  7. 2556036Species Pea (Pisum sativum) [TaxId:3888] [276244] (8 PDB entries)
  8. 2556037Domain d7dkzc_: 7dkz C: [402227]
    Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzd_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_
    automated match to d5oy0c_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkzc_

PDB Entry: 7dkz (more details), 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d7dkzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dkzc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

SCOPe Domain Coordinates for d7dkzc_:

Click to download the PDB-style file with coordinates for d7dkzc_.
(The format of our PDB-style files is described here.)

Timeline for d7dkzc_: