SCOPe 2.08: Domain d7dkzc_: 7dkz C:

Lineage for d7dkzc_ (7dkz C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein automated matches [236563] (10 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276244] (9 PDB entries)

8. Domain d7dkzc_: 7dkz C: [402227]
   Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzd_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_, d7dkzl_
   automated match to d5oy0c_
   complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkzc_

PDB Entry: 7dkz, 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex

PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d7dkzc_:

Sequence; same for both SEQRES and ATOM records:

>d7dkzc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

Timeline for d7dkzc_:

• d7dkzc_ first appeared in SCOPe 2.07