Lineage for d7ljsc1 (7ljs C:2-183)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689683Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 2689684Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
    includes the N-terminal tail and the linker to domain 2
  7. 2689685Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries)
  8. 2689704Domain d7ljsc1: 7ljs C:2-183 [402222]
    Other proteins in same PDB: d7ljsa2, d7ljsa3, d7ljsa4, d7ljsa5, d7ljsb2, d7ljsb3, d7ljsb4, d7ljsb5, d7ljsc2, d7ljsc3, d7ljsc4, d7ljsc5, d7ljsd2, d7ljsd3, d7ljsd4, d7ljsd5
    automated match to d1gtea1
    complexed with fad, fmn, sf4, y3g

Details for d7ljsc1

PDB Entry: 7ljs (more details), 2 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) complexed with 5- ethynyluracil (5eu) - open form
PDB Compounds: (C:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljsc1 a.1.2.2 (C:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOPe Domain Coordinates for d7ljsc1:

Click to download the PDB-style file with coordinates for d7ljsc1.
(The format of our PDB-style files is described here.)

Timeline for d7ljsc1: