Lineage for d7ljtc5 (7ljt C:845-1017)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556102Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2556117Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 2556118Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries)
  8. 2556145Domain d7ljtc5: 7ljt C:845-1017 [402203]
    Other proteins in same PDB: d7ljta1, d7ljta2, d7ljta3, d7ljta4, d7ljtb1, d7ljtb2, d7ljtb3, d7ljtb4, d7ljtc1, d7ljtc2, d7ljtc3, d7ljtc4, d7ljtd1, d7ljtd2, d7ljtd3, d7ljtd4
    automated match to d1gtea5
    complexed with fad, fmn, nap, sf4, y3g

Details for d7ljtc5

PDB Entry: 7ljt (more details), 1.98 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) soaked with 5- ethynyluracil (5eu), nadph - 20 minutes
PDB Compounds: (C:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljtc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljtc5 d.58.1.5 (C:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrgl

SCOPe Domain Coordinates for d7ljtc5:

Click to download the PDB-style file with coordinates for d7ljtc5.
(The format of our PDB-style files is described here.)

Timeline for d7ljtc5: