Lineage for d7ljtc3 (7ljt C:288-440)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457627Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 2457640Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)
  7. 2457641Species Pig (Sus scrofa) [TaxId:9823] [51912] (9 PDB entries)
  8. 2457668Domain d7ljtc3: 7ljt C:288-440 [402201]
    Other proteins in same PDB: d7ljta1, d7ljta2, d7ljta4, d7ljta5, d7ljtb1, d7ljtb2, d7ljtb4, d7ljtb5, d7ljtc1, d7ljtc2, d7ljtc4, d7ljtc5, d7ljtd1, d7ljtd2, d7ljtd4, d7ljtd5
    automated match to d1gtea3
    complexed with fad, fmn, nap, sf4, y3g

Details for d7ljtc3

PDB Entry: 7ljt (more details), 1.98 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) soaked with 5- ethynyluracil (5eu), nadph - 20 minutes
PDB Compounds: (C:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljtc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljtc3 c.3.1.1 (C:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

SCOPe Domain Coordinates for d7ljtc3:

Click to download the PDB-style file with coordinates for d7ljtc3.
(The format of our PDB-style files is described here.)

Timeline for d7ljtc3: