![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries) |
![]() | Domain d7ljud5: 7lju D:845-1019 [402192] Other proteins in same PDB: d7ljua1, d7ljua2, d7ljua3, d7ljua4, d7ljub1, d7ljub2, d7ljub3, d7ljub4, d7ljuc1, d7ljuc2, d7ljuc3, d7ljuc4, d7ljud1, d7ljud2, d7ljud3, d7ljud4 automated match to d1gted5 complexed with fad, fnr, nap, sf4, y3g |
PDB Entry: 7lju (more details), 1.87 Å
SCOPe Domain Sequences for d7ljud5:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljud5 d.58.1.5 (D:845-1019) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpl
Timeline for d7ljud5:
![]() Domains from same chain: (mouse over for more information) d7ljud1, d7ljud2, d7ljud3, d7ljud4 |