Lineage for d7ljud4 (7lju D:533-844)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436768Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 2436769Species Pig (Sus scrofa) [TaxId:9823] [51411] (9 PDB entries)
  8. 2436789Domain d7ljud4: 7lju D:533-844 [402191]
    Other proteins in same PDB: d7ljua1, d7ljua2, d7ljua3, d7ljua5, d7ljub1, d7ljub2, d7ljub3, d7ljub5, d7ljuc1, d7ljuc2, d7ljuc3, d7ljuc5, d7ljud1, d7ljud2, d7ljud3, d7ljud5
    automated match to d1gted2
    complexed with fad, fnr, nap, sf4, y3g

Details for d7ljud4

PDB Entry: 7lju (more details), 1.87 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) crosslinked with 5- ethynyluracil (5eu)
PDB Compounds: (D:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljud4:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ljud4 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOPe Domain Coordinates for d7ljud4:

Click to download the PDB-style file with coordinates for d7ljud4.
(The format of our PDB-style files is described here.)

Timeline for d7ljud4: