![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51411] (9 PDB entries) |
![]() | Domain d7ljud4: 7lju D:533-844 [402191] Other proteins in same PDB: d7ljua1, d7ljua2, d7ljua3, d7ljua5, d7ljub1, d7ljub2, d7ljub3, d7ljub5, d7ljuc1, d7ljuc2, d7ljuc3, d7ljuc5, d7ljud1, d7ljud2, d7ljud3, d7ljud5 automated match to d1gted2 complexed with fad, fnr, nap, sf4, y3g has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 7lju (more details), 1.87 Å
SCOPe Domain Sequences for d7ljud4:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljud4 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
Timeline for d7ljud4:
![]() Domains from same chain: (mouse over for more information) d7ljud1, d7ljud2, d7ljud3, d7ljud5 |