Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51912] (9 PDB entries) |
Domain d7ljud3: 7lju D:288-440 [402190] Other proteins in same PDB: d7ljua1, d7ljua2, d7ljua4, d7ljua5, d7ljub1, d7ljub2, d7ljub4, d7ljub5, d7ljuc1, d7ljuc2, d7ljuc4, d7ljuc5, d7ljud1, d7ljud2, d7ljud4, d7ljud5 automated match to d1gted3 complexed with fad, fnr, nap, sf4, y3g |
PDB Entry: 7lju (more details), 1.87 Å
SCOPe Domain Sequences for d7ljud3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ljud3 c.3.1.1 (D:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq fvrteqdetgkwnededqivhlkadvvisafgs
Timeline for d7ljud3:
View in 3D Domains from same chain: (mouse over for more information) d7ljud1, d7ljud2, d7ljud4, d7ljud5 |