SCOPe 2.08: Domain d7jqyd_: 7jqy D:

Lineage for d7jqyd_ (7jqy D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [261487] (3 PDB entries)

8. Domain d7jqyd_: 7jqy D: [402185]
   automated match to d3qyja_

Details for d7jqyd_

PDB Entry: 7jqy, 2.15 Å

PDB Description: crystal structure of cfl1-d123s from burkholderia cenocepacia

PDB Compounds: (D:) Cif-like 1

SCOPe Domain Sequences for d7jqyd_:

Sequence; same for both SEQRES and ATOM records:

>d7jqyd_ c.69.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
pgmpapglpagferrfsrryaqlddvrlhyvtggpddgemvvllhgwpqtwytwrhvmpa
laedgyrvvavdyrgagesdkplggydkasmagdiralvhqlgatrihlvgrsigvmvay
ayaaqwpteivklamldvpvpgtriwdeakasadpqiwhfglhqqrdiaemliagkeray
ildfykkrthvalsnddiavyadayaapgalragfelyrafpqdetrfkafmkhklpmpv
lalagdksngakeldmarelaldvrgavapntghwlpdenpafltrqlldffre

Timeline for d7jqyd_:

• d7jqyd_ first appeared in SCOPe 2.07