Lineage for d7ljsd5 (7ljs D:845-1019)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949247Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 2949248Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries)
  8. 2949268Domain d7ljsd5: 7ljs D:845-1019 [402182]
    Other proteins in same PDB: d7ljsa1, d7ljsa2, d7ljsa3, d7ljsa4, d7ljsb1, d7ljsb2, d7ljsb3, d7ljsb4, d7ljsc1, d7ljsc2, d7ljsc3, d7ljsc4, d7ljsd1, d7ljsd2, d7ljsd3, d7ljsd4
    automated match to d1gted5
    complexed with fad, fmn, sf4, y3g

Details for d7ljsd5

PDB Entry: 7ljs (more details), 2 Å

PDB Description: porcine dihydropyrimidine dehydrogenase (dpd) complexed with 5- ethynyluracil (5eu) - open form
PDB Compounds: (D:) Dihydropyrimidine dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d7ljsd5:

Sequence, based on SEQRES records: (download)

>d7ljsd5 d.58.1.5 (D:845-1019) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpl

Sequence, based on observed residues (ATOM records): (download)

>d7ljsd5 d.58.1.5 (D:845-1019) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnale
rkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgy
qaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpl

SCOPe Domain Coordinates for d7ljsd5:

Click to download the PDB-style file with coordinates for d7ljsd5.
(The format of our PDB-style files is described here.)

Timeline for d7ljsd5: