Lineage for d1fcda3 (1fcd A:328-401)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 81994Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 81995Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 82019Protein Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit [55443] (1 species)
  7. 82020Species Purple phototrophic bacterium (Chromatium vinosum) [TaxId:1049] [55444] (1 PDB entry)
  8. 82021Domain d1fcda3: 1fcd A:328-401 [40218]
    Other proteins in same PDB: d1fcda1, d1fcda2, d1fcdb1, d1fcdb2, d1fcdc1, d1fcdc2, d1fcdd1, d1fcdd2

Details for d1fcda3

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution

SCOP Domain Sequences for d1fcda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcda3 d.87.1.1 (A:328-401) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum)}
pgtpsylntcysilapaygisvaaiyrpnadgsaiesvpdsggvtpvdapdwvlerevqy
ayswynnivhdtfg

SCOP Domain Coordinates for d1fcda3:

Click to download the PDB-style file with coordinates for d1fcda3.
(The format of our PDB-style files is described here.)

Timeline for d1fcda3: