![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [353118] (4 PDB entries) |
![]() | Domain d7kwua2: 7kwu A:430-554 [402176] Other proteins in same PDB: d7kwua1, d7kwub_ automated match to d1dloa1 complexed with edo, k7f, mg, so4 |
PDB Entry: 7kwu (more details), 2.02 Å
SCOPe Domain Sequences for d7kwua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kwua2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klvsa
Timeline for d7kwua2: