Lineage for d7kwua2 (7kwu A:430-554)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495224Species Human immunodeficiency virus type 1 [TaxId:11676] [353118] (4 PDB entries)
  8. 2495225Domain d7kwua2: 7kwu A:430-554 [402176]
    Other proteins in same PDB: d7kwua1, d7kwub_
    automated match to d1dloa1
    complexed with edo, k7f, mg, so4

Details for d7kwua2

PDB Entry: 7kwu (more details), 2.02 Å

PDB Description: crystal structure of hiv-1 rt in complex with 16c (k07-15)
PDB Compounds: (A:) Reverse transcriptase p66

SCOPe Domain Sequences for d7kwua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kwua2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOPe Domain Coordinates for d7kwua2:

Click to download the PDB-style file with coordinates for d7kwua2.
(The format of our PDB-style files is described here.)

Timeline for d7kwua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7kwua1
View in 3D
Domains from other chains:
(mouse over for more information)
d7kwub_