Lineage for d1dxld3 (1dxl D:348-470)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 81994Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 81995Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 81996Protein Dihydrolipoamide dehydrogenase [55436] (7 species)
  7. 82006Species Garden pea (Pisum sativum) [TaxId:3888] [55442] (1 PDB entry)
  8. 82010Domain d1dxld3: 1dxl D:348-470 [40217]
    Other proteins in same PDB: d1dxla1, d1dxla2, d1dxlb1, d1dxlb2, d1dxlc1, d1dxlc2, d1dxld1, d1dxld2

Details for d1dxld3

PDB Entry: 1dxl (more details), 3.15 Å

PDB Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum

SCOP Domain Sequences for d1dxld3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxld3 d.87.1.1 (D:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum)}
ydkvpgvvytnpevasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaek
etdkilgvhimapnageliheaaialqydassediarvchahptmseaikeaamatydkp
ihi

SCOP Domain Coordinates for d1dxld3:

Click to download the PDB-style file with coordinates for d1dxld3.
(The format of our PDB-style files is described here.)

Timeline for d1dxld3: