Lineage for d1dxlc3 (1dxl C:348-470)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528292Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2528293Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2528301Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 2528319Species Pea (Pisum sativum) [TaxId:3888] [55442] (1 PDB entry)
  8. 2528322Domain d1dxlc3: 1dxl C:348-470 [40216]
    Other proteins in same PDB: d1dxla1, d1dxla2, d1dxlb1, d1dxlb2, d1dxlc1, d1dxlc2, d1dxld1, d1dxld2
    complexed with fad

Details for d1dxlc3

PDB Entry: 1dxl (more details), 3.15 Å

PDB Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum
PDB Compounds: (C:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1dxlc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxlc3 d.87.1.1 (C:348-470) Dihydrolipoamide dehydrogenase {Pea (Pisum sativum) [TaxId: 3888]}
ydkvpgvvytnpevasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaek
etdkilgvhimapnageliheaaialqydassediarvchahptmseaikeaamatydkp
ihi

SCOPe Domain Coordinates for d1dxlc3:

Click to download the PDB-style file with coordinates for d1dxlc3.
(The format of our PDB-style files is described here.)

Timeline for d1dxlc3: