Lineage for d7kjoa_ (7kjo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803791Domain d7kjoa_: 7kjo A: [402154]
    Other proteins in same PDB: d7kjob2
    automated match to d1u29a_
    complexed with gol, so4

Details for d7kjoa_

PDB Entry: 7kjo (more details), 1.45 Å

PDB Description: crystal structure of plekha7 ph domain biding so4
PDB Compounds: (A:) Pleckstrin homology domain-containing family A member 7

SCOPe Domain Sequences for d7kjoa_:

Sequence, based on SEQRES records: (download)

>d7kjoa_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvvrgwlhkqdssgmrlwkrrwfvladyclfyykdsreeavlgsiplpsyvispvaped
risrkysfkavhtgmraliynsstagsqaeqsgmrtyyfsadtqedmnawvramnqaaqv

Sequence, based on observed residues (ATOM records): (download)

>d7kjoa_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvvrgwlhkqdssgmrlwkrrwfvladyclfyykdsreeavlgsiplpsyvispvaped
risrkysfkavhtgmrtyyfsadtqedmnawvramnqaaqv

SCOPe Domain Coordinates for d7kjoa_:

Click to download the PDB-style file with coordinates for d7kjoa_.
(The format of our PDB-style files is described here.)

Timeline for d7kjoa_: