Lineage for d1dxlb3 (1dxl B:348-470)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34139Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 34140Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 34141Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins)
  6. 34142Protein Dihydrolipoamide dehydrogenase [55436] (6 species)
  7. 34149Species Garden pea (Pisum sativum) [TaxId:3888] [55442] (1 PDB entry)
  8. 34151Domain d1dxlb3: 1dxl B:348-470 [40215]
    Other proteins in same PDB: d1dxla1, d1dxla2, d1dxlb1, d1dxlb2, d1dxlc1, d1dxlc2, d1dxld1, d1dxld2

Details for d1dxlb3

PDB Entry: 1dxl (more details), 3.15 Å

PDB Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum

SCOP Domain Sequences for d1dxlb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxlb3 d.87.1.1 (B:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum)}
ydkvpgvvytnpevasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaek
etdkilgvhimapnageliheaaialqydassediarvchahptmseaikeaamatydkp
ihi

SCOP Domain Coordinates for d1dxlb3:

Click to download the PDB-style file with coordinates for d1dxlb3.
(The format of our PDB-style files is described here.)

Timeline for d1dxlb3: