SCOPe 2.08: Domain d7dkz4_: 7dkz 4:

Lineage for d7dkz4_ (7dkz 4:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)

8. Domain d7dkz4_: 7dkz 4: [402141]
   Other proteins in same PDB: d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_, d7dkzl_
   automated match to d5l8r4_
   complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkz4_

PDB Entry: 7dkz, 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex

PDB Compounds: (4:) chlorophyll a-b binding protein p4, chloroplastic

SCOPe Domain Sequences for d7dkz4_:

Sequence; same for both SEQRES and ATOM records:

>d7dkz4_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
kgewlpglaspgyltgslpgdngfdplglaedpenlkwfvqaelvngrwamlgvagmllp
evftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpif
kqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfdn
llqhisdpwhntivq

Timeline for d7dkz4_:

• d7dkz4_ first appeared in SCOPe 2.07