Lineage for d1bhya3 (1bhy A:471-598)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569463Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2569464Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2569472Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 2569487Species Neisseria meningitidis [TaxId:487] [55441] (2 PDB entries)
  8. 2569489Domain d1bhya3: 1bhy A:471-598 [40213]
    Other proteins in same PDB: d1bhya1, d1bhya2
    complexed with fad

Details for d1bhya3

PDB Entry: 1bhy (more details), 4.18 Å

PDB Description: low temperature middle resolution structure of p64k from masc data
PDB Compounds: (A:) p64k

SCOPe Domain Sequences for d1bhya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhya3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}
arvipgvaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifda
etgriigggivgpnggdmigevylaiemgcdaadigktihphptlgesigmaaevalgtc
tdlppqkk

SCOPe Domain Coordinates for d1bhya3:

Click to download the PDB-style file with coordinates for d1bhya3.
(The format of our PDB-style files is described here.)

Timeline for d1bhya3: