Lineage for d1bhy_3 (1bhy 471-598)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135463Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 135464Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 135465Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 135466Protein Dihydrolipoamide dehydrogenase [55436] (7 species)
  7. 135481Species Neisseria meningitidis [TaxId:487] [55441] (2 PDB entries)
  8. 135483Domain d1bhy_3: 1bhy 471-598 [40213]
    Other proteins in same PDB: d1bhy_1, d1bhy_2

Details for d1bhy_3

PDB Entry: 1bhy (more details), 4.18 Å

PDB Description: low temperature middle resolution structure of p64k from masc data

SCOP Domain Sequences for d1bhy_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhy_3 d.87.1.1 (471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis}
arvipgvaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifda
etgriigggivgpnggdmigevylaiemgcdaadigktihphptlgesigmaaevalgtc
tdlppqkk

SCOP Domain Coordinates for d1bhy_3:

Click to download the PDB-style file with coordinates for d1bhy_3.
(The format of our PDB-style files is described here.)

Timeline for d1bhy_3: