Lineage for d1bhy_3 (1bhy 471-598)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) 
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins) 
Protein Dihydrolipoamide dehydrogenase [55436] (6 species) 
Species Neisseria meningitidis [TaxId:487] [55441] (2 PDB entries) 
Domain d1bhy_3: 1bhy 471-598 [40213]
Other proteins in same PDB: d1bhy_1, d1bhy_2
Details for d1bhy_3
PDB Entry: 1bhy (more details), 4.18 Å
PDB Description: low temperature middle resolution structure of p64k from masc data
SCOP Domain Sequences for d1bhy_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhy_3 d.87.1.1 (471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis}
arvipgvaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifda
etgriigggivgpnggdmigevylaiemgcdaadigktihphptlgesigmaaevalgtc
tdlppqkk
SCOP Domain Coordinates for d1bhy_3:
Click to download the PDB-style file with coordinates for d1bhy_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bhy_3:
- d1bhy_3 appears in SCOP 1.57
- d1bhy_3 appears in the current release, SCOPe 2.08, called d1bhya3
View in 3D
