SCOPe 2.08: Domain d1bhya3: 1bhy A:471-598

Lineage for d1bhya3 (1bhy A:471-598)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Dihydrolipoamide dehydrogenase [55436] (8 species)

7. Species Neisseria meningitidis [TaxId:487] [55441] (2 PDB entries)

8. Domain d1bhya3: 1bhy A:471-598 [40213]
   Other proteins in same PDB: d1bhya1, d1bhya2
   complexed with fad

Details for d1bhya3

PDB Entry: 1bhy, 4.18 Å

PDB Description: low temperature middle resolution structure of p64k from masc data

PDB Compounds: (A:) p64k

SCOPe Domain Sequences for d1bhya3:

Sequence; same for both SEQRES and ATOM records:

>d1bhya3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}
arvipgvaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifda
etgriigggivgpnggdmigevylaiemgcdaadigktihphptlgesigmaaevalgtc
tdlppqkk

Timeline for d1bhya3:

• d1bhya3 first appeared (with stable ids) in SCOP 1.55, called d1bhy_3
  
• d1bhya3 appears in SCOPe 2.07