Lineage for d1ojt_3 (1ojt 471-598)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) 
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (9 proteins) 
Protein Dihydrolipoamide dehydrogenase [55436] (7 species) 
Species Neisseria meningitidis [TaxId:487] [55441] (2 PDB entries) 
Domain d1ojt_3: 1ojt 471-598 [40212]
Other proteins in same PDB: d1ojt_1, d1ojt_2
Details for d1ojt_3
PDB Entry: 1ojt (more details), 2.7 Å
PDB Description: structure of dihydrolipoamide dehydrogenase
SCOP Domain Sequences for d1ojt_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojt_3 d.87.1.1 (471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis}
arvipgvaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifda
etgriigggivgpnggdmigevclaiemgcdaadigktihphptlgesigmaaevalgtc
tdlppqkk
SCOP Domain Coordinates for d1ojt_3:
Click to download the PDB-style file with coordinates for d1ojt_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ojt_3:
- d1ojt_3 first appeared (with stable ids) in SCOP 1.55
- d1ojt_3 appears in SCOP 1.59
- d1ojt_3 appears in SCOP 1.63
- d1ojt_3 appears in the current release, SCOPe 2.08, called d1ojta3
View in 3D
