Lineage for d1ojt_3 (1ojt 471-598)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 81994Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 81995Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 81996Protein Dihydrolipoamide dehydrogenase [55436] (7 species)
  7. 82011Species Neisseria meningitidis [TaxId:487] [55441] (2 PDB entries)
  8. 82012Domain d1ojt_3: 1ojt 471-598 [40212]
    Other proteins in same PDB: d1ojt_1, d1ojt_2

Details for d1ojt_3

PDB Entry: 1ojt (more details), 2.7 Å

PDB Description: structure of dihydrolipoamide dehydrogenase

SCOP Domain Sequences for d1ojt_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojt_3 d.87.1.1 (471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis}
arvipgvaytspevawvgetelsakasarkitkanfpwaasgraiangcdkpftklifda
etgriigggivgpnggdmigevclaiemgcdaadigktihphptlgesigmaaevalgtc
tdlppqkk

SCOP Domain Coordinates for d1ojt_3:

Click to download the PDB-style file with coordinates for d1ojt_3.
(The format of our PDB-style files is described here.)

Timeline for d1ojt_3: