Lineage for d7k6cc_ (7k6c C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511722Species Mycobacteroides abscessus [TaxId:561007] [402107] (1 PDB entry)
  8. 2511725Domain d7k6cc_: 7k6c C: [402112]
    automated match to d3ghva_
    complexed with ca, edo, mmv, nap

Details for d7k6cc_

PDB Entry: 7k6c (more details), 2 Å

PDB Description: crystal structure of dihydrofolate reductase (dhfr) from mycobacterium abscessus atcc 19977 / dsm 44196 with nadp and inhibitor p218
PDB Compounds: (C:) dihydrofolate reductase

SCOPe Domain Sequences for d7k6cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k6cc_ c.71.1.0 (C:) automated matches {Mycobacteroides abscessus [TaxId: 561007]}
gtigliwaqtragvigadgaipwrlpedqarfkritmghtvimgrktweslpgsvrplpg
rpnivltrdalfepdgalavgsadaalaasdeapwvigggeiyrlflplaqrcevtvvea
dvpgdalapelgegwvvetndwqtsesglryqflsyrkv

SCOPe Domain Coordinates for d7k6cc_:

Click to download the PDB-style file with coordinates for d7k6cc_.
(The format of our PDB-style files is described here.)

Timeline for d7k6cc_: