SCOPe 2.08: Domain d7k78l1: 7k78 L:23-141

Lineage for d7k78l1 (7k78 L:23-141)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d7k78l1: 7k78 L:23-141 [402105]
   Other proteins in same PDB: d7k78b_, d7k78c_, d7k78d_, d7k78f_, d7k78g_, d7k78h_
   automated match to d4f9lc2
   protein/DNA complex

Details for d7k78l1

PDB Entry: 7k78, 3.1 Å

PDB Description: antibody and nucleosome complex

PDB Compounds: (L:) ScFv

SCOPe Domain Sequences for d7k78l1:

Sequence; same for both SEQRES and ATOM records:

>d7k78l1 b.1.1.0 (L:23-141) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvepgtsvkmpckasgytftsytiqwvkqtprqglewigyiypynagtky
nekfkgkatltsdkssstvymelssltsedsavyycarkssrlrstldywgqgtsvtvs

Timeline for d7k78l1:

• d7k78l1 first appeared in SCOPe 2.07