Lineage for d1ebda3 (1ebd A:347-461)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962845Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 2962849Species Bacillus stearothermophilus [TaxId:1422] [55440] (1 PDB entry)
  8. 2962850Domain d1ebda3: 1ebd A:347-461 [40210]
    Other proteins in same PDB: d1ebda1, d1ebda2, d1ebdb1, d1ebdb2, d1ebdc_
    complexed with fad

Details for d1ebda3

PDB Entry: 1ebd (more details), 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1ebda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
aipavvfsdpecasvgyfeqqakdegidviaakfpfaangralalndtdgflklvvrked
gviigaqiigpnasdmiaelglaieagmtaedialtihahptlgeiameaaeval

SCOPe Domain Coordinates for d1ebda3:

Click to download the PDB-style file with coordinates for d1ebda3.
(The format of our PDB-style files is described here.)

Timeline for d1ebda3: