SCOPe 2.08: Domain d1ebda3: 1ebd A:347-461

Lineage for d1ebda3 (1ebd A:347-461)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Dihydrolipoamide dehydrogenase [55436] (8 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55440] (1 PDB entry)

8. Domain d1ebda3: 1ebd A:347-461 [40210]
   Other proteins in same PDB: d1ebda1, d1ebda2, d1ebdb1, d1ebdb2, d1ebdc_
   complexed with fad

Details for d1ebda3

PDB Entry: 1ebd, 2.6 Å

PDB Description: dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase

PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1ebda3:

Sequence; same for both SEQRES and ATOM records:

>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
aipavvfsdpecasvgyfeqqakdegidviaakfpfaangralalndtdgflklvvrked
gviigaqiigpnasdmiaelglaieagmtaedialtihahptlgeiameaaeval

Timeline for d1ebda3:

• d1ebda3 first appeared (with stable ids) in SCOP 1.55
  
• d1ebda3 appears in SCOPe 2.07