Lineage for d3ladb3 (3lad B:349-472)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81993Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 81994Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 81995Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 81996Protein Dihydrolipoamide dehydrogenase [55436] (7 species)
  7. 81997Species Azotobacter vinelandii [TaxId:354] [55439] (1 PDB entry)
  8. 81999Domain d3ladb3: 3lad B:349-472 [40209]
    Other proteins in same PDB: d3lada1, d3lada2, d3ladb1, d3ladb2

Details for d3ladb3

PDB Entry: 3lad (more details), 2.2 Å

PDB Description: refined crystal structure of lipoamide dehydrogenase from azotobacter vinelandii at 2.2 angstroms resolution. a comparison with the structure of glutathione reductase

SCOP Domain Sequences for d3ladb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ladb3 d.87.1.1 (B:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii}
ydlipaviythpeiagvgkteqalkaegvainvgvfpfaasgramaandtagfvkviada
ktdrvlgvhvigpsaaelvqqgaiamefgtsaedlgmmvfahpalsealheaalavsgha
ihva

SCOP Domain Coordinates for d3ladb3:

Click to download the PDB-style file with coordinates for d3ladb3.
(The format of our PDB-style files is described here.)

Timeline for d3ladb3: