Lineage for d3ladb3 (3lad B:349-472)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182994Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2182995Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2182996Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 protein domains)
  6. 2183004Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 2183005Species Azotobacter vinelandii [TaxId:354] [55439] (1 PDB entry)
  8. 2183007Domain d3ladb3: 3lad B:349-472 [40209]
    Other proteins in same PDB: d3lada1, d3lada2, d3ladb1, d3ladb2
    complexed with fad

Details for d3ladb3

PDB Entry: 3lad (more details), 2.2 Å

PDB Description: refined crystal structure of lipoamide dehydrogenase from azotobacter vinelandii at 2.2 angstroms resolution. a comparison with the structure of glutathione reductase
PDB Compounds: (B:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d3ladb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ladb3 d.87.1.1 (B:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}
ydlipaviythpeiagvgkteqalkaegvainvgvfpfaasgramaandtagfvkviada
ktdrvlgvhvigpsaaelvqqgaiamefgtsaedlgmmvfahpalsealheaalavsgha
ihva

SCOPe Domain Coordinates for d3ladb3:

Click to download the PDB-style file with coordinates for d3ladb3.
(The format of our PDB-style files is described here.)

Timeline for d3ladb3: