| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
Superfamily c.65.1: Formyltransferase [53328] (2 families) ![]() |
| Family c.65.1.1: Formyltransferase [53329] (5 proteins) |
| Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82468] (30 PDB entries) |
| Domain d7jg0a_: 7jg0 A: [402075] automated match to d4zyva_ complexed with gar, v97 |
PDB Entry: 7jg0 (more details), 1.98 Å
SCOPe Domain Sequences for d7jg0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jg0a_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv
Timeline for d7jg0a_: