Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (9 proteins) |
Protein Dihydrolipoamide dehydrogenase [55436] (7 species) |
Species Pseudomonas fluorescens [TaxId:294] [55438] (1 PDB entry) |
Domain d1lpfb3: 1lpf B:349-472 [40207] Other proteins in same PDB: d1lpfa1, d1lpfa2, d1lpfb1, d1lpfb2 complexed with fad |
PDB Entry: 1lpf (more details), 2.8 Å
SCOP Domain Sequences for d1lpfb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lpfb3 d.87.1.1 (B:349-472) Dihydrolipoamide dehydrogenase {Pseudomonas fluorescens} ydlipsviythpeiawvgkteqtlkaegvevnvgtfpfaasgramaandttglvkviada ktdrvlgvhvigpsaaelvqqgaigmefgtsaedlgmmvfshptlsealheaalavngha ihia
Timeline for d1lpfb3: