Lineage for d7jqyg_ (7jqy G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509559Species Burkholderia cenocepacia [TaxId:216591] [261487] (3 PDB entries)
  8. 2509570Domain d7jqyg_: 7jqy G: [402066]
    automated match to d3qyja_

Details for d7jqyg_

PDB Entry: 7jqy (more details), 2.15 Å

PDB Description: crystal structure of cfl1-d123s from burkholderia cenocepacia
PDB Compounds: (G:) Cif-like 1

SCOPe Domain Sequences for d7jqyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jqyg_ c.69.1.0 (G:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
pgmpapglpagferrfsrryaqlddvrlhyvtggpddgemvvllhgwpqtwytwrhvmpa
laedgyrvvavdyrgagesdkplggydkasmagdiralvhqlgatrihlvgrsigvmvay
ayaaqwpteivklamldvpvpgtriwdeakasadpqiwhfglhqqrdiaemliagkeray
ildfykkrthvalsnddiavyadayaapgalragfelyrafpqdetrfkafmkhklpmpv
lalagdksngakeldmarelaldvrgavapntghwlpdenpafltrqlldffr

SCOPe Domain Coordinates for d7jqyg_:

Click to download the PDB-style file with coordinates for d7jqyg_.
(The format of our PDB-style files is described here.)

Timeline for d7jqyg_: