SCOPe 2.08: Domain d1lpfa3: 1lpf A:349-472

Lineage for d1lpfa3 (1lpf A:349-472)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Dihydrolipoamide dehydrogenase [55436] (8 species)

7. Species Pseudomonas fluorescens [TaxId:294] [55438] (1 PDB entry)

8. Domain d1lpfa3: 1lpf A:349-472 [40206]
   Other proteins in same PDB: d1lpfa1, d1lpfa2, d1lpfb1, d1lpfb2
   complexed with fad

Details for d1lpfa3

PDB Entry: 1lpf, 2.8 Å

PDB Description: three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties

PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1lpfa3:

Sequence; same for both SEQRES and ATOM records:

>d1lpfa3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Pseudomonas fluorescens [TaxId: 294]}
ydlipsviythpeiawvgkteqtlkaegvevnvgtfpfaasgramaandttglvkviada
ktdrvlgvhvigpsaaelvqqgaigmefgtsaedlgmmvfshptlsealheaalavngha
ihia

Timeline for d1lpfa3:

• d1lpfa3 first appeared (with stable ids) in SCOP 1.55
  
• d1lpfa3 appears in SCOPe 2.07