Lineage for d1lpfa3 (1lpf A:349-472)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962845Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 2962868Species Pseudomonas fluorescens [TaxId:294] [55438] (1 PDB entry)
  8. 2962869Domain d1lpfa3: 1lpf A:349-472 [40206]
    Other proteins in same PDB: d1lpfa1, d1lpfa2, d1lpfb1, d1lpfb2
    complexed with fad

Details for d1lpfa3

PDB Entry: 1lpf (more details), 2.8 Å

PDB Description: three-dimensional structure of lipoamide dehydrogenase from pseudomonas fluorescens at 2.8 angstroms resolution. analysis of redox and thermostability properties
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1lpfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpfa3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Pseudomonas fluorescens [TaxId: 294]}
ydlipsviythpeiawvgkteqtlkaegvevnvgtfpfaasgramaandttglvkviada
ktdrvlgvhvigpsaaelvqqgaigmefgtsaedlgmmvfshptlsealheaalavngha
ihia

SCOPe Domain Coordinates for d1lpfa3:

Click to download the PDB-style file with coordinates for d1lpfa3.
(The format of our PDB-style files is described here.)

Timeline for d1lpfa3: