SCOP 1.75: Domain d1lvla3: 1lvl A:336-458

Lineage for d1lvla3 (1lvl A:336-458)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Dihydrolipoamide dehydrogenase [55436] (8 species)

7. Species Pseudomonas putida [TaxId:303] [55437] (1 PDB entry)

8. Domain d1lvla3: 1lvl A:336-458 [40205]
   Other proteins in same PDB: d1lvla1, d1lvla2
   complexed with fad, nad

Details for d1lvla3

PDB Entry: 1lvl, 2.45 Å

PDB Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution

PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOP Domain Sequences for d1lvla3:

Sequence; same for both SEQRES and ATOM records:

>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}
paaiaavcftdpevvvvgktpeqasqqgldcivaqfpfaangramslesksgfvrvvarr
dnhlilgwqavgvavselstafaqslemgacledvagtihahptlgeavqeaalralgha
lhi

Timeline for d1lvla3:

• d1lvla3 first appeared (with stable ids) in SCOP 1.55, called d1lvl_3
  
• d1lvla3 appears in SCOP 1.73
  
• d1lvla3 appears in SCOPe 2.01
  
• d1lvla3 appears in the current release, SCOPe 2.08