Lineage for d1lvl_3 (1lvl 336-458)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194320Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 194321Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 194322Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (9 proteins)
  6. 194329Protein Dihydrolipoamide dehydrogenase [55436] (7 species)
  7. 194350Species Pseudomonas putida [TaxId:303] [55437] (1 PDB entry)
  8. 194351Domain d1lvl_3: 1lvl 336-458 [40205]
    Other proteins in same PDB: d1lvl_1, d1lvl_2

Details for d1lvl_3

PDB Entry: 1lvl (more details), 2.45 Å

PDB Description: the refined structure of pseudomonas putida lipoamide dehydrogenase complexed with nad+ at 2.45 angstroms resolution

SCOP Domain Sequences for d1lvl_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvl_3 d.87.1.1 (336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida}
paaiaavcftdpevvvvgktpeqasqqgldcivaqfpfaangramslesksgfvrvvarr
dnhlilgwqavgvavselstafaqslemgacledvagtihahptlgeavqeaalralgha
lhi

SCOP Domain Coordinates for d1lvl_3:

Click to download the PDB-style file with coordinates for d1lvl_3.
(The format of our PDB-style files is described here.)

Timeline for d1lvl_3: