Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Scribble (KIAA0147) [101731] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101732] (9 PDB entries) Uniprot Q14160 680-951, 1096-1193 # structure of 1st PDZ domain is also known, 1XQ5 |
Domain d7jo7a1: 7jo7 A:860-949 [402031] Other proteins in same PDB: d7jo7a2, d7jo7b2, d7jo7c2, d7jo7d2 automated match to d2h3lb_ complexed with edo |
PDB Entry: 7jo7 (more details), 2.44 Å
SCOPe Domain Sequences for d7jo7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7jo7a1 b.36.1.1 (A:860-949) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} rhvaclarserglgfsiaggkgstpyragdagifvsriaeggaahragtlqvgdrvlsin gvdvtearhdhavslltaasptialllere
Timeline for d7jo7a1: