SCOPe 2.08: Domain d7dtkb_: 7dtk B:

Lineage for d7dtkb_ (7dtk B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [346304] (8 PDB entries)

8. Domain d7dtkb_: 7dtk B: [402008]
   automated match to d2gxqa_
   complexed with gol

Details for d7dtkb_

PDB Entry: 7dtk, 1.85 Å

PDB Description: crystal structure of the reca1 domain of rna helicase cgh-1 in c. elegans

PDB Compounds: (B:) ATP-dependent RNA helicase cgh-1

SCOPe Domain Sequences for d7dtkb_:

Sequence; same for both SEQRES and ATOM records:

>d7dtkb_ c.37.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gvefedfclgrdllmgifekgwekpspiqeasigvaltgqdilarakngtgktgaycipv
iekiqpalkaiqamvivptrelalqtsqicvelskhiqlkvmvttggtdlrddimrlngt
vhlviatpgrildlmekgvakmehcktlvldeadkllsqdfqgildrlinflpkerqvml
ysatfpntvtsfmqkhmhkpyein

Timeline for d7dtkb_:

• d7dtkb_ first appeared in SCOPe 2.07