Lineage for d7ebzc_ (7ebz C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431815Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2431816Protein automated matches [190988] (22 species)
    not a true protein
  7. 2431935Species Human enterovirus d68 [TaxId:42789] [401999] (2 PDB entries)
  8. 2431939Domain d7ebzc_: 7ebz C: [402000]
    Other proteins in same PDB: d7ebzf1
    automated match to d4wm8c_

Details for d7ebzc_

PDB Entry: 7ebz (more details), 3.09 Å

PDB Description: ev-d68 in complex with 2h12 fab (state s1)
PDB Compounds: (C:) capsid protein vp3

SCOPe Domain Sequences for d7ebzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ebzc_ b.121.4.0 (C:) automated matches {Human enterovirus d68 [TaxId: 42789]}
gvptyllpgsgqflttddhssapalpcfnptpemhipgqvrnmlevvqvesmmeinntes
avgmerlkvdisaltdvdqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
gsfmaagklilcytppggscpttretamlgthivwdfglqssvtliipwisgshyrmfnn
dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqldhlh
aaeaayq

SCOPe Domain Coordinates for d7ebzc_:

Click to download the PDB-style file with coordinates for d7ebzc_.
(The format of our PDB-style files is described here.)

Timeline for d7ebzc_: