Lineage for d7dj2b_ (7dj2 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028745Fold f.54: SNF-like [161069] (1 superfamily)
    12 transmembrane helices; duplication: consists of two structurally similar halves
  4. 3028746Superfamily f.54.1: SNF-like [161070] (3 families) (S)
  5. 3028747Family f.54.1.1: SNF-like [161071] (2 proteins)
    Pfam PF00209; Sodium:neurotransmitter symporter
  6. 3028802Protein automated matches [190994] (2 species)
    not a true protein
  7. 3028807Species Aquifex aeolicus [TaxId:63363] [188708] (7 PDB entries)
  8. 3028811Domain d7dj2b_: 7dj2 B: [401997]
    automated match to d4hmka_
    complexed with bog, leu, na; mutant

Details for d7dj2b_

PDB Entry: 7dj2 (more details), 2.4 Å

PDB Description: crystal structure of the g26c/e290s mutant of leut
PDB Compounds: (B:) Na(+):neurotransmitter symporter (Snf family)

SCOPe Domain Sequences for d7dj2b_:

Sequence, based on SEQRES records: (download)

>d7dj2b_ f.54.1.1 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
rehwatrlglilamagnavglcnflrfpvqaaengggafmipyiiafllvgiplmwiewa
mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
glvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsili
rgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvw
iaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekasvilggsisipaava
ffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmi
afledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiff
wifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvw
itrfyiiglflfltflvflaerrr

Sequence, based on observed residues (ATOM records): (download)

>d7dj2b_ f.54.1.1 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
rehwatrlglilamagnavglcnflrfpvqaaengggafmipyiiafllvgiplmwiewa
mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
glvpeppatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirg
iskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwia
avgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekasvilggsisipaavaff
gvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmiaf
ledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwi
fgadkaweeinrggiikvpriyyyvmryitpaflavllvvwarethwtvwitrfyiiglf
lfltflvflaerrr

SCOPe Domain Coordinates for d7dj2b_:

Click to download the PDB-style file with coordinates for d7dj2b_.
(The format of our PDB-style files is described here.)

Timeline for d7dj2b_: