Lineage for d1nhs_3 (1nhs 322-447)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135463Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 135464Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 135465Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 135532Protein NADH peroxidase [55432] (1 species)
  7. 135533Species Enterococcus faecalis [TaxId:1351] [55433] (8 PDB entries)
  8. 135537Domain d1nhs_3: 1nhs 322-447 [40199]
    Other proteins in same PDB: d1nhs_1, d1nhs_2

Details for d1nhs_3

PDB Entry: 1nhs (more details), 2.1 Å

PDB Description: an l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide

SCOP Domain Sequences for d1nhs_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhs_3 d.87.1.1 (322-447) NADH peroxidase {Enterococcus faecalis}
gvqgssglavfdykfastginevmaqklgketkavtvvedylmdfnpdkqkawfklvydp
ettqilgaqlmskadltaninaislaiqakmtiedlayadfffqpafdkpwniintaale
avkqer

SCOP Domain Coordinates for d1nhs_3:

Click to download the PDB-style file with coordinates for d1nhs_3.
(The format of our PDB-style files is described here.)

Timeline for d1nhs_3: