SCOPe 2.07: Domain d7ea9a2: 7ea9 A:222-575

Lineage for d7ea9a2 (7ea9 A:222-575)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)

8. Domain d7ea9a2: 7ea9 A:222-575 [401989]
   Other proteins in same PDB: d7ea9a1, d7ea9b1, d7ea9c1, d7ea9d1
   automated match to d3bjua2
   complexed with gol, kaa; mutant

Details for d7ea9a2

PDB Entry: 7ea9, 2.5 Å

PDB Description: crystal structure of human lysyl-trna synthetase y145h mutant

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d7ea9a2:

Sequence; same for both SEQRES and ATOM records:

>d7ea9a2 d.104.1.0 (A:222-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dketryrqryldlilndfvrqkfiirskiityirsfldelgfleietpmmniipggavak
pfityhneldmnlymriapelyhkmlvvggidrvyeigrqfrnegidlthnpefttcefy
mayadyhdlmeitekmvsgmvkhitgsykvtyhpdgpegqaydvdftppfrrinmveele
kalgmklpetnlfeteetrkilddicvakavecppprttarlldklvgeflevtcinptf
icdhpqimsplakwhrskeglterfelfvmkkeicnaytelndpmrqrqlfeeqakakaa
gddeamfidenfctaleyglpptagwgmgidrvamfltdsnnikevllfpamkp

Timeline for d7ea9a2:

• d7ea9a2 is new in SCOPe 2.07-stable
  
• d7ea9a2 appears in the current release, SCOPe 2.08