SCOPe 2.07: Domain d7ea9c1: 7ea9 C:71-221

Lineage for d7ea9c1 (7ea9 C:71-221)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225402] (14 PDB entries)

8. Domain d7ea9c1: 7ea9 C:71-221 [401982]
   Other proteins in same PDB: d7ea9a2, d7ea9b2, d7ea9c2, d7ea9d2
   automated match to d3bjua1
   complexed with gol, kaa; mutant

Details for d7ea9c1

PDB Entry: 7ea9, 2.5 Å

PDB Description: crystal structure of human lysyl-trna synthetase y145h mutant

PDB Compounds: (C:) Lysine--tRNA ligase

SCOPe Domain Sequences for d7ea9c1:

Sequence, based on SEQRES records:

>d7ea9c1 b.40.4.0 (C:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
rihakrasggklifhdlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
tkkgelsiipyeitllspclhmlphlhfglk

Sequence, based on observed residues (ATOM records):

>d7ea9c1 b.40.4.0 (C:71-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpnqyykirsqaihqlkvngedpyphkfhvdisltdfiqkyshlqpgdhltditlkvag
rihakrasggklifhdlrgegvklqvmansrnykseeefihinnklrrgdiigvqgnpgk
tkkgelsiipyeitllspclhmlphglk

Timeline for d7ea9c1:

• d7ea9c1 is new in SCOPe 2.07-stable
  
• d7ea9c1 appears in the current release, SCOPe 2.08