SCOPe 2.08: Domain d7e6qb_: 7e6q B:

Lineage for d7e6qb_ (7e6q B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.0: automated matches [191452] (1 protein)
   not a true family

6. Protein automated matches [190692] (20 species)
   not a true protein

7. Species Influenza a virus (strain a/duck/alberta/60/1976 h12n5) [TaxId:385582] [401973] (1 PDB entry)

8. Domain d7e6qb_: 7e6q B: [401974]
   automated match to d4qn5a_
   complexed with ca, hzf, nag

Details for d7e6qb_

PDB Entry: 7e6q, 2.2 Å

PDB Description: crystal structure of influenza a virus neuraminidase n5 complexed with 4'-phenyl-1,2,3-triazolylated oseltamivir carboxylate

PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d7e6qb_:

Sequence; same for both SEQRES and ATOM records:

>d7e6qb_ b.68.1.0 (B:) automated matches {Influenza a virus (strain a/duck/alberta/60/1976 h12n5) [TaxId: 385582]}
peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
iwtsssstvfcgvssevpgwswddgailpfdidk

Timeline for d7e6qb_:

• d7e6qb_ first appeared in SCOPe 2.07