Lineage for d7dkzj_ (7dkz J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631539Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 2631562Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 2631563Protein automated matches [276198] (4 species)
    not a true protein
  7. 2631573Species Pea (Pisum sativum) [TaxId:3888] [276201] (7 PDB entries)
  8. 2631574Domain d7dkzj_: 7dkz J: [401972]
    Other proteins in same PDB: d7dkz1_, d7dkz2_, d7dkz3_, d7dkz4_, d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzf_
    automated match to d5l8rj_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkzj_

PDB Entry: 7dkz (more details), 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d7dkzj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dkzj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mrdlktylsvapvastlwfaalagllieinrffpdaltf

SCOPe Domain Coordinates for d7dkzj_:

Click to download the PDB-style file with coordinates for d7dkzj_.
(The format of our PDB-style files is described here.)

Timeline for d7dkzj_: