Lineage for d1nhq_3 (1nhq 322-447)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34139Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 34140Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 34141Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (7 proteins)
  6. 34196Protein NADH peroxidase [55432] (1 species)
  7. 34197Species Enterococcus faecalis [TaxId:1351] [55433] (8 PDB entries)
  8. 34199Domain d1nhq_3: 1nhq 322-447 [40197]
    Other proteins in same PDB: d1nhq_1, d1nhq_2

Details for d1nhq_3

PDB Entry: 1nhq (more details), 2 Å

PDB Description: crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303

SCOP Domain Sequences for d1nhq_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhq_3 d.87.1.1 (322-447) NADH peroxidase {Enterococcus faecalis}
gvqgssglavfdykfastginevmaqklgketkavtvvedylmdfnpdkqkawfklvydp
ettqilgaqlmskadltaninaislaiqakmtiedlayadfffqpafdkpwniintaale
avkqer

SCOP Domain Coordinates for d1nhq_3:

Click to download the PDB-style file with coordinates for d1nhq_3.
(The format of our PDB-style files is described here.)

Timeline for d1nhq_3: