Lineage for d1nhqa3 (1nhq A:322-447)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962926Protein NADH peroxidase [55432] (1 species)
  7. 2962927Species Enterococcus faecalis [TaxId:1351] [55433] (8 PDB entries)
  8. 2962930Domain d1nhqa3: 1nhq A:322-447 [40197]
    Other proteins in same PDB: d1nhqa1, d1nhqa2
    complexed with fad, so4; mutant

Details for d1nhqa3

PDB Entry: 1nhq (more details), 2 Å

PDB Description: crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
PDB Compounds: (A:) nadh peroxidase

SCOPe Domain Sequences for d1nhqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhqa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}
gvqgssglavfdykfastginevmaqklgketkavtvvedylmdfnpdkqkawfklvydp
ettqilgaqlmskadltaninaislaiqakmtiedlayadfffqpafdkpwniintaale
avkqer

SCOPe Domain Coordinates for d1nhqa3:

Click to download the PDB-style file with coordinates for d1nhqa3.
(The format of our PDB-style files is described here.)

Timeline for d1nhqa3: