Lineage for d7dkz3_ (7dkz 3:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633630Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2633631Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2633682Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 2633683Protein automated matches [276200] (4 species)
    not a true protein
  7. 2633718Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries)
  8. 2633721Domain d7dkz3_: 7dkz 3: [401966]
    Other proteins in same PDB: d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_
    automated match to d5l8r3_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d7dkz3_

PDB Entry: 7dkz (more details), 2.39 Å

PDB Description: structure of plant photosystem i-light harvesting complex i supercomplex
PDB Compounds: (3:) Chlorophyll a-b binding protein 3, chloroplastic

SCOPe Domain Sequences for d7dkz3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dkz3_ f.43.1.0 (3:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
plwfaskqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgavg
aiapeylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfqd
wakpgsmgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrlam
lailgyfiqglvtgvgpyqnlldhvadpvnnnvlts

SCOPe Domain Coordinates for d7dkz3_:

Click to download the PDB-style file with coordinates for d7dkz3_.
(The format of our PDB-style files is described here.)

Timeline for d7dkz3_: