SCOPe 2.08: Domain d7d1tu_: 7d1t u:

Lineage for d7d1tu_ (7d1t u:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189920] (20 PDB entries)

8. Domain d7d1tu_: 7d1t u: [401954]
   Other proteins in same PDB: d7d1ta_, d7d1tb_, d7d1tc_, d7d1td_, d7d1te_, d7d1tf_, d7d1th_, d7d1tj_, d7d1tk_, d7d1tl_, d7d1tm_, d7d1to_, d7d1tv_, d7d1tx_, d7d1tz_
   automated match to d5h2fu_
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d7d1tu_

PDB Entry: 7d1t, 1.95 Å

PDB Description: cryo-em structure of psii at 1.95 angstrom resolution

PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d7d1tu_:

Sequence; same for both SEQRES and ATOM records:

>d7d1tu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus vulcanus [TaxId: 32053]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d7d1tu_:

• d7d1tu_ first appeared in SCOPe 2.07