SCOPe 2.08: Domain d7daee_: 7dae E:

Lineage for d7daee_ (7dae E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [390534] (14 PDB entries)

8. Domain d7daee_: 7dae E: [401939]
   Other proteins in same PDB: d7daea1, d7daea2, d7daeb1, d7daeb2, d7daec1, d7daec2, d7daed1, d7daed2, d7daef1, d7daef2, d7daef3
   automated match to d4i55e_
   complexed with acp, ca, cl, epb, gdp, gtp, mes, mg

Details for d7daee_

PDB Entry: 7dae, 2.39 Å

PDB Description: epb in complex with tubulin

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d7daee_:

Sequence, based on SEQRES records:

>d7daee_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeeas

Sequence, based on observed residues (ATOM records):

>d7daee_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eeas

Timeline for d7daee_:

• d7daee_ first appeared in SCOPe 2.07