Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Staphylococcus equorum [TaxId:246432] [349736] (3 PDB entries) |
Domain d7ddwc2: 7ddw C:91-199 [401935] Other proteins in same PDB: d7ddwa1, d7ddwb1, d7ddwc1, d7ddwd1, d7ddwe1, d7ddwf1 automated match to d1xrea2 complexed with mn; mutant |
PDB Entry: 7ddw (more details), 1.88 Å
SCOPe Domain Sequences for d7ddwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ddwc2 d.44.1.0 (C:91-199) automated matches {Staphylococcus equorum [TaxId: 246432]} nseekgtvvdkikeqwgsldafkeefanqaaarfgcgwawlvvndgkleivttpnqdnpl tegktpilgldvwehayylkyqnkrpdyisafwnvvnwekvdelynaak
Timeline for d7ddwc2: